Search Antibody, Protein, and ELISA Kit Solutions

CRLF1 Antibody - middle region (ARP36672_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36672_P050-FITC Conjugated

ARP36672_P050-HRP Conjugated

ARP36672_P050-Biotin Conjugated

Gene Symbol:
CRLF1
Official Gene Full Name:
Cytokine receptor-like factor 1
NCBI Gene Id:
9244
Protein Name:
Cytokine receptor-like factor 1
Swissprot Id:
O75462
Protein Accession #:
NP_004741
Nucleotide Accession #:
NM_004750
Alias Symbols:
CISS, CISS1, CLF, CLF-1, NR6, zcytor5
Replacement Item:
This antibody may replace item sc-100297 from Santa Cruz Biotechnology.
Description of Target:
CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
Protein Size (# AA):
422
Molecular Weight:
46kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CRLF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CRLF1.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-CRLF1 (ARP36672_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CLCF1; CNTFR;
Blocking Peptide:
For anti-CRLF1 (ARP36672_P050) antibody is Catalog # AAP36672 (Previous Catalog # AAPP08005)
Datasheets/Manuals:
Printable datasheet for anti-CRLF1 (ARP36672_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...