| Sku |
AAP36672 |
| Old sku |
AAPP08005 |
| Price |
$99.00 |
| Name |
CRLF1 Peptide - middle region (AAP36672) |
| Purchase info |
To purchase this peptide:
- Copy peptide sku
- Click on this link
- Paste into field "Peptide Sku"
|
| Size |
100ug |
| Gene |
CRLF1 |
| Alias symbols |
CISS, CISS1, CLF, CLF-1, NR6, zcytor5 |
| Gene id |
9244 |
| Description of target |
CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome. |
| Swissprot id |
O75462 |
| Protein accession num |
NP_004741 |
| Nucleotide accession num |
NM_004750 |
| Protein size |
422 amino acids |
| Molecular weight |
46kDa |
| Species reactivity |
Human |
| Application |
WB |
| Peptide sequence |
KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP |
| Partner proteins |
CLCF1,CNTFR,CLCF1 |
| Quality control |
The peptide is characterized by mass spectroscopy |
| Key reference |
N/A |
| Description |
This is a synthetic peptide designed for use in combination with anti-CRLF1 Antibody (ARP36672_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details. |
| Product format |
Lyophilized powder |
| Reconstitution and storage |
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. |
| Lead time |
Domestic: within 24 hours delivery International: 3-5 business days |
| Protocol |
|
| Tips |
See our General FAQ page. |
| Availability |
In Stock |
