| Product Number |
ARP34923_P050 |
| Product Page |
www.avivasysbio.com/kcna1-antibody-middle-region-arp34923-p050.html |
| Name |
KCNA1 Antibody - middle region (ARP34923_P050) |
| Protein Size (# AA) |
495 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
3736 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) |
| Alias Symbols |
EA1, MK1, AEMK, HBK1, HUK1, MBK1, RBK1, KV1.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tan,K.M., (2008) Neurology 70 (20), 1883-1890 |
| Description of Target |
KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
KCNRG; KCNE4; DLG4; DLG1; KCNA4; KCNA3; KCNA2; RTN4; CNTNAP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNA1 (ARP34923_P050) antibody |
| Blocking Peptide |
For anti-KCNA1 (ARP34923_P050) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human KCNA1 |
| Uniprot ID |
Q09470 |
| Protein Name |
Potassium voltage-gated channel subfamily A member 1 |
| Publications |
Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. Basic Res. Cardiol. 110, 505 (2015). 26162324 |
| Protein Accession # |
NP_000208 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000217 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNA1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93% |
| Image 1 | Human Stomach
 | WB Suggested Anti-KCNA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach |
|
