Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34923_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34923_P050-FITC Conjugated

ARP34923_P050-HRP Conjugated

ARP34923_P050-Biotin Conjugated

KCNA1 Antibody - middle region (ARP34923_P050)

Catalog#: ARP34923_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-11182 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human KCNA1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data Anti-KCNA1 (ARP34923_P050)
Peptide Sequence Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-KCNA1 (ARP34923_P050) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147)
Datasheets/Manuals Printable datasheet for anti-KCNA1 (ARP34923_P050) antibody
Target Reference Tan,K.M., (2008) Neurology 70 (20), 1883-1890
Publications

Glasscock, E; Voigt, N; McCauley, MD; Sun, Q; Li, N; Chiang, DY; Zhou, XB; Molina, CE; Thomas, D; Schmidt, C; Skapura, DG; Noebels, JL; Dobrev, D; Wehrens, XH; Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. 110, 505 (2015). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26162324

Gene Symbol KCNA1
Official Gene Full Name Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Alias Symbols AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1, RBK1
NCBI Gene Id 3736
Protein Name Potassium voltage-gated channel subfamily A member 1
Description of Target KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id Q09470
Protein Accession # NP_000208
Nucleotide Accession # NM_000217
Protein Size (# AA) 495
Molecular Weight 56kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express KCNA1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express KCNA1.
Protein Interactions KCNRG; KCNE4; DLG4; DLG1; KCNA4; KCNA3; KCNA2; RTN4; CNTNAP1;
  1. What is the species homology for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat".

  2. How long will it take to receive "KCNA1 Antibody - middle region (ARP34923_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNA1 Antibody - middle region (ARP34923_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    This target may also be called "AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1, RBK1" in publications.

  5. What is the shipping cost for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "KCNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNA1 Antibody - middle region (ARP34923_P050)
Your Rating
We found other products you might like!