Search Antibody, Protein, and ELISA Kit Solutions

KCNA1 antibody - middle region (ARP34923_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34923_P050-FITC Conjugated

ARP34923_P050-HRP Conjugated

ARP34923_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Protein Name:
Potassium voltage-gated channel subfamily A member 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1, RBK1
Replacement Item:
This antibody may replace item sc-11182 from Santa Cruz Biotechnology.
Description of Target:
KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNA1.
The immunogen is a synthetic peptide directed towards the middle region of human KCNA1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data:
Anti-KCNA1 (ARP34923_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-KCNA1 (ARP34923_P050) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147)
Printable datasheet for anti-KCNA1 (ARP34923_P050) antibody
Target Reference:
Tan,K.M., (2008) Neurology 70 (20), 1883-1890

Glasscock, E; Voigt, N; McCauley, MD; Sun, Q; Li, N; Chiang, DY; Zhou, XB; Molina, CE; Thomas, D; Schmidt, C; Skapura, DG; Noebels, JL; Dobrev, D; Wehrens, XH; Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. 110, 505 (2015). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26162324

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...