SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP34923_P050
Price: $0.00
SKU
ARP34923_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KCNA1 (ARP34923_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human KCNA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNA1 (ARP34923_P050) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147)
ReferenceTan,K.M., (2008) Neurology 70 (20), 1883-1890
Publications

Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. Basic Res. Cardiol. 110, 505 (2015). 26162324

Gene SymbolKCNA1
Gene Full NamePotassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Alias SymbolsEA1, MK1, AEMK, HBK1, HUK1, MBK1, RBK1, KV1.1
NCBI Gene Id3736
Protein NamePotassium voltage-gated channel subfamily A member 1
Description of TargetKCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ09470
Protein Accession #NP_000208
Nucleotide Accession #NM_000217
Protein Size (# AA)495
Molecular Weight56kDa
Protein InteractionsKCNRG; KCNE4; DLG4; DLG1; KCNA4; KCNA3; KCNA2; RTN4; CNTNAP1;
  1. What is the species homology for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "KCNA1 Antibody - middle region (ARP34923_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNA1 Antibody - middle region (ARP34923_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    This target may also be called "EA1, MK1, AEMK, HBK1, HUK1, MBK1, RBK1, KV1.1" in publications.

  5. What is the shipping cost for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNA1 Antibody - middle region (ARP34923_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNA1 Antibody - middle region (ARP34923_P050)
Your Rating
We found other products you might like!