Search Antibody, Protein, and ELISA Kit Solutions

KCNA1 Antibody - middle region (ARP34923_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34923_P050-FITC Conjugated

ARP34923_P050-HRP Conjugated

ARP34923_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-11182 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human KCNA1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Complete computational species homology data:
Anti-KCNA1 (ARP34923_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-KCNA1 (ARP34923_P050) antibody is Catalog # AAP34923 (Previous Catalog # AAPP06147)
Datasheets/Manuals:
Printable datasheet for anti-KCNA1 (ARP34923_P050) antibody
Target Reference:
Tan,K.M., (2008) Neurology 70 (20), 1883-1890
Publications:

Glasscock, E; Voigt, N; McCauley, MD; Sun, Q; Li, N; Chiang, DY; Zhou, XB; Molina, CE; Thomas, D; Schmidt, C; Skapura, DG; Noebels, JL; Dobrev, D; Wehrens, XH; Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. 110, 505 (2015). WB, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat 26162324

Gene Symbol:
KCNA1
Official Gene Full Name:
Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
Alias Symbols:
AEMK, EA1, HBK1, HUK1, KV1.1, MBK1, MGC126782, MGC138385, MK1, RBK1
NCBI Gene Id:
3736
Protein Name:
Potassium voltage-gated channel subfamily A member 1
Description of Target:
KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Q09470
Protein Accession #:
NP_000208
Nucleotide Accession #:
NM_000217
Protein Size (# AA):
495
Molecular Weight:
56kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express KCNA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express KCNA1.
Protein Interactions:
KCNRG; KCNE4; DLG4; DLG1; KCNA4; KCNA3; KCNA2; RTN4; CNTNAP1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...