MBD4 Antibody - middle region (ARP34797_P050)

• Product Number: ARP34797_P050
• Name: MBD4 Antibody - middle region (ARP34797_P050)
• Protein Size (# AA): 580 amino acids
• Molecular Weight: 66kDa
• NCBI Gene Id: 8930
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Methyl-CpG binding domain protein 4
• Description:
  View product citations for MBD4 Antibody - middle region (ARP34797_P050) on CiteAb
• Alias Symbols: MED1
• Peptide Sequence: Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Miao,R., (er) Lung Cancer (2008) In press
• Description of Target: MBD4 is involved with DNA methylation. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD3 comprise a family of nuclear proteins related by??he presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: KDM1A; SUV39H1; HTT; FAS; SUMO2; UBC; CDCA2; Trim27; FADD; MLH1; CSNK2B; DNMT3B; SIN3A; HDAC1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MBD4 (ARP34797_P050) antibody is Catalog # AAP34797 (Previous Catalog # AAPP05991)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD4
• Uniprot ID: O95243
• Protein Name: Methyl-CpG-binding domain protein 4
• Publications:

  DNMT1 cooperates with MBD4 to inhibit the expression of Glucocorticoid-induced TNFR-related protein in human T cells. FEBS Lett. 591, 1929-1939 (2017). 28542810

• Sample Type Confirmation:

  MBD4 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_003916
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003925
• Tested Species Reactivity: Human
• Gene Symbol: MBD4
• Predicted Species Reactivity: Human, Guinea Pig
• Application: WB, CHIP
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 83%; Human: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-MBD4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Hela cell lysateMBD4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
• Image 2: HCT116
  
  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.