Search Antibody, Protein, and ELISA Kit Solutions

MBD4 Antibody - middle region (ARP34797_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34797_P050-FITC Conjugated

ARP34797_P050-HRP Conjugated

ARP34797_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Guinea Pig, Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-10753 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MBD4
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 83%; Human: 100%
Complete computational species homology data:
Anti-MBD4 (ARP34797_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MBD4 (ARP34797_P050) antibody is Catalog # AAP34797 (Previous Catalog # AAPP05991)
Datasheets/Manuals:
Printable datasheet for anti-MBD4 (ARP34797_P050) antibody
Sample Type Confirmation:

MBD4 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Reference:
Miao,R., (er) Lung Cancer (2008) In press
Gene Symbol:
MBD4
Official Gene Full Name:
Methyl-CpG binding domain protein 4
Alias Symbols:
MED1
NCBI Gene Id:
8930
Protein Name:
Methyl-CpG-binding domain protein 4
Description of Target:
MBD4 is involved with DNA methylation. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD3 comprise a family of nuclear proteins related by??he presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
O95243
Protein Accession #:
NP_003916
Nucleotide Accession #:
NM_003925
Protein Size (# AA):
580
Molecular Weight:
66kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MBD4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MBD4.
Protein Interactions:
KDM1A; SUV39H1; HTT; FAS; SUMO2; UBC; CDCA2; Trim27; FADD; MLH1; CSNK2B; DNMT3B; SIN3A; HDAC1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...