Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34797_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34797_P050-FITC Conjugated

ARP34797_P050-HRP Conjugated

ARP34797_P050-Biotin Conjugated

MBD4 Antibody - middle region (ARP34797_P050)

Catalog#: ARP34797_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Guinea Pig, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10753 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBD4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Guinea Pig: 83%; Human: 100%
Complete computational species homology data Anti-MBD4 (ARP34797_P050)
Peptide Sequence Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MBD4 (ARP34797_P050) antibody is Catalog # AAP34797 (Previous Catalog # AAPP05991)
Datasheets/Manuals Printable datasheet for anti-MBD4 (ARP34797_P050) antibody
Sample Type Confirmation

MBD4 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Miao,R., (er) Lung Cancer (2008) In press
Gene Symbol MBD4
Official Gene Full Name Methyl-CpG binding domain protein 4
Alias Symbols MED1
NCBI Gene Id 8930
Protein Name Methyl-CpG-binding domain protein 4
Description of Target MBD4 is involved with DNA methylation. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD3 comprise a family of nuclear proteins related by??he presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O95243
Protein Accession # NP_003916
Nucleotide Accession # NM_003925
Protein Size (# AA) 580
Molecular Weight 66kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MBD4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MBD4.
Protein Interactions KDM1A; SUV39H1; HTT; FAS; SUMO2; UBC; CDCA2; Trim27; FADD; MLH1; CSNK2B; DNMT3B; SIN3A; HDAC1;
  1. What is the species homology for "MBD4 Antibody - middle region (ARP34797_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Guinea Pig, Human".

  2. How long will it take to receive "MBD4 Antibody - middle region (ARP34797_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MBD4 Antibody - middle region (ARP34797_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MBD4 Antibody - middle region (ARP34797_P050)"?

    This target may also be called "MED1" in publications.

  5. What is the shipping cost for "MBD4 Antibody - middle region (ARP34797_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MBD4 Antibody - middle region (ARP34797_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MBD4 Antibody - middle region (ARP34797_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MBD4 Antibody - middle region (ARP34797_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MBD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MBD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MBD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MBD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MBD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MBD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MBD4 Antibody - middle region (ARP34797_P050)
Your Rating
We found other products you might like!