TAF4 Antibody - middle region (ARP33394_P050)

• Product Number: ARP33394_P050
• Name: TAF4 Antibody - middle region (ARP33394_P050)
• Protein Size (# AA): 1085 amino acids
• Molecular Weight: 110kDa
• Subunit: 4
• NCBI Gene Id: 6874
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
• Alias Symbols: TAF2C, TAF4A, TAF2C1, TAFII130, TAFII135, TAFII-130, TAFII-135, TAF(II)130, TAF(II)135
• Peptide Sequence: Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Liu,W.L., (2008) Mol. Cell 29 (1), 81-91
• Description of Target: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF4 is one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SOX6; SUMO2; UBC; FBXO6; MED26; HIST3H3; TBP; GTF2F2; JUN; SP1; HTT; AHR; TAF9B; TRRAP; TAF13; TAF1L; TAF3; TAF10; TAF9; TAF7; TAF6; TAF1; TAF12; ELAVL1; TAF8; ATF7; TCF12; CREB1; TBPL1; GTF2A1; TAF11; TAF5; TAF2; CBX5; CBX3; GTF2A2; CREM; SAP130; SUPT3H;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TAF4 (ARP33394_P050) antibody is Catalog # AAP33394 (Previous Catalog # AAPP04440)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF4
• Uniprot ID: O00268
• Protein Name: Transcription initiation factor TFIID subunit 4
• Sample Type Confirmation:

  TAF4 is supported by BioGPS gene expression data to be expressed in HEK293T

• Protein Accession #: NP_003176
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003185
• Tested Species Reactivity: Human
• Gene Symbol: TAF4
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB, CHIP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 78%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
• Image 1: Human 293T
  
  WB Suggested Anti-TAF4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysateTAF4 is supported by BioGPS gene expression data to be expressed in HEK293T
• Image 2: HCT116
  
  Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.