Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP33394_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33394_P050-FITC Conjugated

ARP33394_P050-HRP Conjugated

ARP33394_P050-Biotin Conjugated

TAF4 Antibody - middle region (ARP33394_P050)

Catalog#: ARP33394_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-136093 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TAF4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 78%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Complete computational species homology data Anti-TAF4 (ARP33394_P050)
Peptide Sequence Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TAF4 (ARP33394_P050) antibody is Catalog # AAP33394 (Previous Catalog # AAPP04440)
Datasheets/Manuals Printable datasheet for anti-TAF4 (ARP33394_P050) antibody
Sample Type Confirmation

TAF4 is supported by BioGPS gene expression data to be expressed in HEK293T

Subunit 4
Target Reference Liu,W.L., (2008) Mol. Cell 29 (1), 81-91
Gene Symbol TAF4
Official Gene Full Name TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
Alias Symbols FLJ41943, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135
NCBI Gene Id 6874
Protein Name Transcription initiation factor TFIID subunit 4
Description of Target Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF4 is one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the larger subunits of TFIID that has been shown to potentiate transcriptional activation by retinoic acid, thyroid hormone and vitamin D3 receptors. In addition, this subunit interacts with the transcription factor CREB, which has a glutamine-rich activation domain, and binds to other proteins containing glutamine-rich regions. Aberrant binding to this subunit by proteins with expanded polyglutamine regions has been suggested as one of the pathogenetic mechanisms underlying a group of neurodegenerative disorders referred to as polyglutamine diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O00268
Protein Accession # NP_003176
Nucleotide Accession # NM_003185
Protein Size (# AA) 1085
Molecular Weight 110kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TAF4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TAF4.
Protein Interactions SOX6; SUMO2; UBC; FBXO6; MED26; HIST3H3; TBP; GTF2F2; JUN; SP1; HTT; AHR; TAF9B; TRRAP; TAF13; TAF1L; TAF3; TAF10; TAF9; TAF7; TAF6; TAF1; TAF12; ELAVL1; TAF8; ATF7; TCF12; CREB1; TBPL1; GTF2A1; TAF11; TAF5; TAF2; CBX5; CBX3; GTF2A2; CREM; SAP130; SUPT3H;
  1. What is the species homology for "TAF4 Antibody - middle region (ARP33394_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit".

  2. How long will it take to receive "TAF4 Antibody - middle region (ARP33394_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TAF4 Antibody - middle region (ARP33394_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TAF4 Antibody - middle region (ARP33394_P050)"?

    This target may also be called "FLJ41943, TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135" in publications.

  5. What is the shipping cost for "TAF4 Antibody - middle region (ARP33394_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TAF4 Antibody - middle region (ARP33394_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TAF4 Antibody - middle region (ARP33394_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "110kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TAF4 Antibody - middle region (ARP33394_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "TAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TAF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TAF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TAF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TAF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TAF4 Antibody - middle region (ARP33394_P050)
Your Rating
We found other products you might like!