| Product Number |
ARP32434_P050 |
| Product Page |
www.avivasysbio.com/eya1-antibody-middle-region-arp32434-p050.html |
| Name |
EYA1 Antibody - middle region (ARP32434_P050) |
| Protein Size (# AA) |
592 amino acids |
| Molecular Weight |
64 kDa |
| NCBI Gene Id |
2138 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Eyes absent homolog 1 (Drosophila) |
| Description |
|
| Alias Symbols |
BOP, BOR, BOS1, OFC1 |
| Peptide Sequence |
Synthetic peptide located within the following region: QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Orten,D.J., (2008) Hum. Mutat. 29 (4), 537-544 |
| Description of Target |
EYA1 is a member of the eyes absent (EYA) family of proteins. EYA1 may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator.This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene. |
| Protein Interactions |
GSK3B; FBXW7; UBC; FZR1; H2AFX; DACH1; SIX2; SIX3; SIX1; GNAI2; GNAZ; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-EYA1 (ARP32434_P050) antibody |
| Blocking Peptide |
For anti-EYA1 (ARP32434_P050) antibody is Catalog # AAP32434 (Previous Catalog # AAPP03430) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EYA1 |
| Uniprot ID |
Q99502 |
| Protein Name |
Eyes absent homolog 1 |
| Publications |
The Eya1 phosphatase promotes Shh signaling during hindbrain development and oncogenesis. Dev Cell. 33, 22-35 (2015). 25816987 |
| Protein Accession # |
NP_742057 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_172060 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
EYA1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human kidney
 | Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody (ARP32434_P050) |
|
| Image 2 | Human brain
 | WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain |
|
| Image 3 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/mL of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/mL. |
|
