Product Number |
ARP31447_P050 |
Product Page |
www.avivasysbio.com/hoxa5-antibody-middle-region-arp31447-p050.html |
Name |
HOXA5 Antibody - middle region (ARP31447_P050) |
Protein Size (# AA) |
270 amino acids |
Molecular Weight |
29kDa |
NCBI Gene Id |
3202 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Homeobox A5 |
Alias Symbols |
HOX1, HOX1C, HOX1.3 |
Peptide Sequence |
Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis. |
Protein Interactions |
PRMT6; TWIST1; UBC; ELAVL1; SOX2; ZNF408; GTF2A1L; SMAD1; DDIT3; PBX1; MEIS1; FOXA2; CDX4; FOXO1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXA5 (ARP31447_P050) antibody |
Additional Information |
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
|
Blocking Peptide |
For anti-HOXA5 (ARP31447_P050) antibody is Catalog # AAP31447 (Previous Catalog # AAPP02209) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA5 |
Uniprot ID |
Q6FG31 |
Protein Name |
HOXA5 protein EMBL CAG47073.1 |
Publications |
Boucherat, O. et al. Partial functional redundancy between Hoxa5 and Hoxb5 paralog genes during lung morphogenesis. Am. J. Physiol. Lung Cell. Mol. Physiol. 304, L817-30 (2013). 23585229 |
Protein Accession # |
NP_061975 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_019102 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
HOXA5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human 721_B
| WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate |
|
Image 3 | Mouse skin
| Sample Type: Mouse dorsal skin -5d postnatalPrimary Antibody Dilution: 1:200Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:500Color/Signal Descriptions: Brown: HOXA5Gene Name: HOXA5Submitted by: Alexander Awgulewitsch, Ph.D.Associate Professor - Dept. of MedicineDirector - MUSC Transgenic Mouse Core Medical University of South Carolina (MUSC)96 Jonathan Lucas St. / Suite 912 CSBCharleston, SC 29425 |
|