Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP31447_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31447_P050-FITC Conjugated

ARP31447_P050-HRP Conjugated

ARP31447_P050-Biotin Conjugated

HOXA5 Antibody - middle region (ARP31447_P050)

Catalog#: ARP31447_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113039 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXA5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-HOXA5 (ARP31447_P050)
Peptide Sequence Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HOXA5 (ARP31447_P050) antibody is Catalog # AAP31447 (Previous Catalog # AAPP02209)
Datasheets/Manuals Printable datasheet for anti-HOXA5 (ARP31447_P050) antibody
Publications

Boucherat, O. et al. Partial functional redundancy between Hoxa5 and Hoxb5 paralog genes during lung morphogenesis. Am. J. Physiol. Lung Cell. Mol. Physiol. 304, L817-30 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23585229

Gene Symbol HOXA5
Official Gene Full Name Homeobox A5
Alias Symbols HOX1, HOX1.3, HOX1C, MGC9376
NCBI Gene Id 3202
Protein Name HOXA5 protein EMBL CAG47073.1
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Swissprot Id Q6FG31
Protein Accession # NP_061975
Nucleotide Accession # NM_019102
Protein Size (# AA) 270
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXA5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXA5.
Protein Interactions PRMT6; TWIST1; UBC; ELAVL1; SOX2; ZNF408; GTF2A1L; SMAD1; DDIT3; PBX1; MEIS1; FOXA2; CDX4; FOXO1;
  1. What is the species homology for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "HOXA5 Antibody - middle region (ARP31447_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HOXA5 Antibody - middle region (ARP31447_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    This target may also be called "HOX1, HOX1.3, HOX1C, MGC9376" in publications.

  5. What is the shipping cost for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HOXA5 Antibody - middle region (ARP31447_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HOXA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HOXA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HOXA5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HOXA5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HOXA5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HOXA5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HOXA5 Antibody - middle region (ARP31447_P050)
Your Rating
We found other products you might like!