Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

HOXA5 Antibody - middle region (ARP31447_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31447_P050-FITC Conjugated

ARP31447_P050-HRP Conjugated

ARP31447_P050-Biotin Conjugated

Gene Symbol:
HOXA5
Official Gene Full Name:
Homeobox A5
NCBI Gene Id:
3202
Protein Name:
HOXA5 protein EMBL CAG47073.1
Swissprot Id:
Q6FG31
Protein Accession #:
NP_061975
Nucleotide Accession #:
NM_019102
Alias Symbols:
HOX1, HOX1.3, HOX1C, MGC9376
Replacement Item:
This antibody may replace item sc-113039 from Santa Cruz Biotechnology.
Description of Target:
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Protein Size (# AA):
270
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HOXA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HOXA5.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human HOXA5
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-HOXA5 (ARP31447_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRMT6; TWIST1; UBC; ELAVL1; SOX2; ZNF408; GTF2A1L; SMAD1; DDIT3; PBX1; MEIS1; FOXA2; CDX4; FOXO1;
Blocking Peptide:
For anti-HOXA5 (ARP31447_P050) antibody is Catalog # AAP31447 (Previous Catalog # AAPP02209)
Datasheets/Manuals:
Printable datasheet for anti-HOXA5 (ARP31447_P050) antibody
Additional Information:
IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Publications:

Boucherat, O. et al. Partial functional redundancy between Hoxa5 and Hoxb5 paralog genes during lung morphogenesis. Am. J. Physiol. Lung Cell. Mol. Physiol. 304, L817-30 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23585229

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...