Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP31447_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31447_P050-FITC Conjugated

ARP31447_P050-HRP Conjugated

ARP31447_P050-Biotin Conjugated

HOXA5 Antibody - middle region (ARP31447_P050)

Catalog#: ARP31447_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded testis tissue, tested with an antibody dilution of 5 ug/ml, followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-113039 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXA5
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-HOXA5 (ARP31447_P050)
Peptide Sequence Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HOXA5 (ARP31447_P050) antibody is Catalog # AAP31447 (Previous Catalog # AAPP02209)
Datasheets/Manuals Printable datasheet for anti-HOXA5 (ARP31447_P050) antibody
Publications

Boucherat, O. et al. Partial functional redundancy between Hoxa5 and Hoxb5 paralog genes during lung morphogenesis. Am. J. Physiol. Lung Cell. Mol. Physiol. 304, L817-30 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 23585229

Gene Symbol HOXA5
Official Gene Full Name Homeobox A5
Alias Symbols HOX1, HOX1.3, HOX1C, MGC9376
NCBI Gene Id 3202
Protein Name HOXA5 protein EMBL CAG47073.1
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Swissprot Id Q6FG31
Protein Accession # NP_061975
Nucleotide Accession # NM_019102
Protein Size (# AA) 270
Molecular Weight 29kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HOXA5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HOXA5.
Protein Interactions PRMT6; TWIST1; UBC; ELAVL1; SOX2; ZNF408; GTF2A1L; SMAD1; DDIT3; PBX1; MEIS1; FOXA2; CDX4; FOXO1;
Write Your Own Review
You're reviewing:HOXA5 Antibody - middle region (ARP31447_P050)
Your Rating