SLC27A2 Antibody - N-terminal region (ARP43855_P050)

Data Sheet
 
Product Number ARP43855_P050
Product Page www.avivasysbio.com/slc27a2-antibody-n-terminal-region-arp43855-p050.html
Name SLC27A2 Antibody - N-terminal region (ARP43855_P050)
Protein Size (# AA) 620 amino acids
Molecular Weight 70 kDa
NCBI Gene Id 11001
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 27 (fatty acid transporter), member 2
Alias Symbols VLCS, FATP2, VLACS, ACSVL1, FACVL1, hFACVL1, HsT17226
Peptide Sequence Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Mihalik,S.J., (2002) J. Biol. Chem. 277 (27), 24771-24779
Description of Target SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
Protein Interactions UBC; YWHAQ; SDHA; PEX14; CALR; ABCD1; PEX5; NCSTN;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-SLC27A2 (ARP43855_P050) antibody
Additional Information IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Blocking Peptide For anti-SLC27A2 (ARP43855_P050) antibody is Catalog # AAP43855 (Previous Catalog # AAPS14404)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2
Uniprot ID O14975
Protein Name Very long-chain acyl-CoA synthetase
Sample Type Confirmation

SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_003636
Purification Affinity Purified
Nucleotide Accession # NM_003645
Tested Species Reactivity Human
Gene Symbol SLC27A2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human HeLa
WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml
Positive Control: Hela cell lysate
Image 2
Human Liver
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Image 3
Human Liver
Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Image 4
Hela, Human lung
Host: Rabbit
Target: SLC27A2
Positive control (+): Hela (HL)
Negative control (-): Human lung (LU)
Antibody concentration: 1ug/ml
Image 5
Human HeLa
Host: Rabbit
Target Name: SLC27A2
Sample Type: Hela
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5.0 ug/ml
Lysate Quantity: 25ug/lane/lane
Gel Concentration: 12%SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com