Product Number |
ARP43855_P050 |
Product Page |
www.avivasysbio.com/slc27a2-antibody-n-terminal-region-arp43855-p050.html |
Name |
SLC27A2 Antibody - N-terminal region (ARP43855_P050) |
Protein Size (# AA) |
620 amino acids |
Molecular Weight |
70 kDa |
NCBI Gene Id |
11001 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 27 (fatty acid transporter), member 2 |
Alias Symbols |
VLCS, FATP2, VLACS, ACSVL1, FACVL1, hFACVL1, HsT17226 |
Peptide Sequence |
Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Mihalik,S.J., (2002) J. Biol. Chem. 277 (27), 24771-24779 |
Description of Target |
SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy. |
Protein Interactions |
UBC; YWHAQ; SDHA; PEX14; CALR; ABCD1; PEX5; NCSTN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-SLC27A2 (ARP43855_P050) antibody |
Additional Information |
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
Blocking Peptide |
For anti-SLC27A2 (ARP43855_P050) antibody is Catalog # AAP43855 (Previous Catalog # AAPS14404) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2 |
Uniprot ID |
O14975 |
Protein Name |
Very long-chain acyl-CoA synthetase |
Sample Type Confirmation |
SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_003636 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003645 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC27A2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-SLC27A2 Antibody Titration: 1 ug/ml Positive Control: Hela cell lysate |
|
Image 2 | Human Liver
| Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
|
Image 3 | Human Liver
| Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE) |
|
Image 4 | Hela, Human lung
| Host: Rabbit Target: SLC27A2 Positive control (+): Hela (HL) Negative control (-): Human lung (LU) Antibody concentration: 1ug/ml |
|
Image 5 | Human HeLa
| Host: Rabbit Target Name: SLC27A2 Sample Type: Hela Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1ug/ml Peptide Concentration: 5.0 ug/ml Lysate Quantity: 25ug/lane/lane Gel Concentration: 12%SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells |
|