website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

SLC27A2 antibody - N-terminal region (ARP43855_P050)

Description of Target:
SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 27 (fatty acid transporter), member 2
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC27A2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC27A2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Very long-chain acyl-CoA synthetase
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC27A2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-SLC27A2 (ARP43855_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat
Datasheets / Downloads:
Printable datasheet for anti-SLC27A2 (ARP43855_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Blocking Peptide:
For anti-SLC27A2 (ARP43855_P050) antibody is Catalog # AAP43855 (Previous Catalog # AAPS14404)
Additional Information:
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Mihalik,S.J., (2002) J. Biol. Chem. 277 (27), 24771-24779
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: SLC27A2 antibody tested by IHC with human liver (arp43855)

Aviva Systems Biology is the original manufacturer of this SLC27A2 antibody.

Click here to view the SLC27A2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SLC27A2 antibody (arp43855)

IHC Information:

Rabbit Anti-SLC27A2 Antibody
Catalog Number: arp43855
Paraffin Embedded Tissue: Human Liver
Antibody Concentration: 10 ug/ml

IHC Image:

Product Protocols: SLC27A2 antibody tested with Human MCF7 Cells (ARP43855_P050)

Aviva Systems Biology is the original manufacturer of this SLC27A2 antibody (ARP43855_P050)

Product Datasheet Link: SLC27A2 antibody (ARP43855_P050)

WB Suggested Anti-SLC27A2 antibody Dilution: 1:1000 (stock 1mg/mL)
Amount of lysate: 25ug
Sample type: Human MCF7
Blocking buffer: TBST-3% milk
Primary antibody concentration: 1ug/mL
Primary antibody incubation time: 4hrs at RT with shaking
Secondary antibody: Goat anti-rabbit-Hrp
Secondary antibody concentration: 0.1ug/mL
Secondary antibody incubation time: 1hr at RT with shaking

Western Blot image: 

Description of Target: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SLC27A2 antibody (ARP43855_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: SLC27A2 antibody tested with Human PANC1 Cells (ARP43855_P050)

Aviva Systems Biology is the original manufacturer of this SLC27A2 antibody (ARP43855_P050)

Product Datasheet Link: SLC27A2 antibody (ARP43855_P050)

WB Suggested Anti-SLC27A2 antibody Dilution: 1:1000 (stock 1mg/mL)
Amount of lysate: 25ug
Sample type: Human PANC1
Blocking buffer: TBST-3% milk
Primary antibody concentration: 1ug/mL
Primary antibody incubation time: 4hrs at RT with shaking
Secondary antibody: Goat anti-rabbit-Hrp
Secondary antibody concentration: 0.1ug/mL
Secondary antibody incubation time: 1hr at RT with shaking

Western Blot image: 

Description of Target: SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s SLC27A2 antibody (ARP43855_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question