website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

SLC27A2 antibody - N-terminal region (ARP43855_P050)

Description of Target:
SLC27A2 is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes, but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme activates long-chain, branched-chain and very-long-chain fatty acids containing 22 or more carbons to their CoA derivatives. It is expressed primarily in liver and kidney, and is present in both endoplasmic reticulum and peroxisomes but not in mitochondria. Its decreased peroxisomal enzyme activity is in part responsible for the biochemical pathology in X-linked adrenoleukodystrophy.
Gene Symbol:
Official Gene Full Name:
Solute carrier family 27 (fatty acid transporter), member 2
NCBI Gene Id:
Alias Symbols:
Sample Type Confirmation:

SLC27A2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Tissue Tool:
Find tissues and cell lines supported to express SLC27A2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Very long-chain acyl-CoA synthetase
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-SLC27A2 antibody: synthetic peptide directed towards the N terminal of human SLC27A2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
SLC27A2 antibody - N-terminal region (ARP43855_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%
Species Reactivity:
Rat, Pig, Human, Mouse, Dog, Bovine, Horse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-SLC27A2 antibody
- ARP43855_P050
Peptide Sequence:
Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW
Blocking Peptide:
For anti-SLC27A2 antibody is Catalog # AAP43855 (Previous Catalog # AAPS14404)
Additional Information:
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Liver, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Mihalik,S.J., (2002) J. Biol. Chem. 277 (27), 24771-24779
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for SLC27A2 antibody (ARP43855)

Product page for SLC27A2 antibody (ARP43855)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Actinoplanes friuliensis pstC antibody A3KFG5 83%
African elephant SLC27A2 antibody; Loxodonta africana SLC27A2 antibody G3SUV0 100%
Bovine SLC27A2 antibody; Bos taurus SLC27A2 antibody F1MQP2 92%
Chromobacterium violaceum depE antibody A4ZPY5 76%
Dog SLC27A2 antibody; Canis familiaris SLC27A2 antibody E2RBJ2 92%
Giant panda SLC27A2 antibody; Ailuropoda melanoleuca SLC27A2 antibody D2HEG7 100%
Gray short-tailed opossum SLC27A2 antibody; Monodelphis domestica SLC27A2 antibody F6YDA1 92%
Gray short-tailed opossum SLC27A2 antibody; Monodelphis domestica SLC27A2 antibody F6YD84 92%
Guinea pig SLC27A2 antibody; Cavia porcellus SLC27A2 antibody H0VA08 92%
Horse SLC27A2 antibody; Equus caballus SLC27A2 antibody F6WIN6 92%
Human S27A2 antibody; Homo sapiens S27A2 antibody O14975 100%
Human SLC27A2 antibody; Homo sapiens SLC27A2 antibody Q6PF09 100%
Human SLC27A2 antibody; Homo sapiens SLC27A2 antibody Q53GS2 100%
Little brown bat SLC27A2 antibody; Myotis lucifugus SLC27A2 antibody G1P5H8 100%
Lowland gorilla SLC27A2 antibody; Gorilla gorilla gorilla SLC27A2 antibody G3QTE5 100%
Mouse S27A2 antibody; Mus musculus S27A2 antibody O35488 100%
Mouse Slc27a2 antibody; Mus musculus Slc27a2 antibody Q3UNR3 100%
Mouse Slc27a2 antibody; Mus musculus Slc27a2 antibody Q3TN99 100%
Northern white-cheeked gibbon SLC27A2 antibody; Nomascus leucogenys SLC27A2 antibody G1R2W0 100%
Pig SLC27A2 antibody; Sus scrofa SLC27A2 antibody F1SQH7 100%
Rabbit SLC27A2 antibody; Oryctolagus cuniculus SLC27A2 antibody G1TNH3 92%
Rabbit SLC27A2 antibody; Oryctolagus cuniculus SLC27A2 antibody G1TCG5 92%
Rat S27A2 antibody; Rattus norvegicus S27A2 antibody P97524 100%
Rat Slc27a2 antibody; Rattus norvegicus Slc27a2 antibody Q66HN6 100%
Rhesus macaque SLC27A2 antibody; Macaca mulatta SLC27A2 antibody F7HFR8 92%
Rhesus macaque SLC27A2 antibody; Macaca mulatta SLC27A2 antibody F7G4F8 92%
Small-eared galago SLC27A2 antibody; Otolemur garnettii SLC27A2 antibody H0WQC1 92%
White-tufted-ear marmoset SLC27A2 antibody; Callithrix jacchus SLC27A2 antibody F7ISY6 100%
White-tufted-ear marmoset SLC27A2 antibody; Callithrix jacchus SLC27A2 antibody F7HXD7 100%

Product Protocols: SLC27A2 antibody tested by IHC with human liver (arp43855)

Aviva Systems Biology is the original manufacturer of this SLC27A2 antibody.

Click here to view the SLC27A2 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: SLC27A2 antibody (arp43855)

IHC Information:

Rabbit Anti-SLC27A2 Antibody
Catalog Number: arp43855
Paraffin Embedded Tissue: Human Liver
Antibody Concentration: 10 ug/ml

IHC Image:

Ask a Question