SLC38A2 Antibody - N-terminal region (ARP33059_P050)

• Product Number: ARP33059_P050
• Name: SLC38A2 Antibody - N-terminal region (ARP33059_P050)
• Protein Size (# AA): 506 amino acids
• Molecular Weight: 56 kDa
• NCBI Gene Id: 54407
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 38, member 2
• Description:
  View product citations for SLC38A2 Antibody - N-terminal region (ARP33059_P050) on CiteAb
• Alias Symbols: ATA2, SAT2, SNAT2, PRO1068
• Peptide Sequence: Synthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Zhang,Z. (2007) Biophys. J. 92 (7), 2621-2632
• Description of Target: Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
• Protein Interactions: UBC; APP; MCU; FLOT1; COX5A; ELAVL1; STX11;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-SLC38A2 (ARP33059_P050) antibody is Catalog # AAP33059 (Previous Catalog # AAPP04088)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2
• Uniprot ID: Q96QD8
• Protein Name: Sodium-coupled neutral amino acid transporter 2
• Publications:

  Amino acids, independent of insulin, attenuate skeletal muscle autophagy in neonatal pigs during endotoxemia. Pediatr. Res. 80, 448-51 (2016). 27064245

  Suryawan, A., Nguyen, H. V, Almonaci, R. D. & Davis, T. A. Abundance of amino acid transporters involved in mTORC1 activation in skeletal muscle of neonatal pigs is developmentally regulated. Amino Acids 45, 523-30 (2013). 22643846

• Sample Type Confirmation:

  SLC38A2 is strongly supported by BioGPS gene expression data to be expressed in HT1080

• Protein Accession #: NP_061849
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018976
• Tested Species Reactivity: Human
• Gene Symbol: SLC38A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Image 1: Human OVCAR-3 Whole Cell
  
  Host: Rabbit
  Target Name: SLC38A2
  Sample Tissue: Human OVCAR-3 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein has two closely sized isoforms and can be glycosylated.