Catalog No: ARP33059_P050
Price: $0.00
SKU
ARP33059_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SLC38A2 (ARP33059_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSFGMSVFNLSNAI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC38A2 (ARP33059_P050) antibody is Catalog # AAP33059 (Previous Catalog # AAPP04088)
Sample Type Confirmation

SLC38A2 is strongly supported by BioGPS gene expression data to be expressed in HT1080

Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceZhang,Z. (2007) Biophys. J. 92 (7), 2621-2632
Publications

Amino acids, independent of insulin, attenuate skeletal muscle autophagy in neonatal pigs during endotoxemia. Pediatr. Res. 80, 448-51 (2016). 27064245

Suryawan, A., Nguyen, H. V, Almonaci, R. D. & Davis, T. A. Abundance of amino acid transporters involved in mTORC1 activation in skeletal muscle of neonatal pigs is developmentally regulated. Amino Acids 45, 523-30 (2013). 22643846

Description
Gene SymbolSLC38A2
Gene Full NameSolute carrier family 38, member 2
Alias SymbolsATA2, SAT2, SNAT2, PRO1068
NCBI Gene Id54407
Protein NameSodium-coupled neutral amino acid transporter 2
Description of TargetUnder hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.
Uniprot IDQ96QD8
Protein Accession #NP_061849
Nucleotide Accession #NM_018976
Protein Size (# AA)506
Molecular Weight56 kDa
Protein InteractionsUBC; APP; MCU; FLOT1; COX5A; ELAVL1; STX11;
  1. What is the species homology for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC38A2 Antibody - N-terminal region (ARP33059_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    This target may also be called "ATA2, SAT2, SNAT2, PRO1068" in publications.

  5. What is the shipping cost for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC38A2 Antibody - N-terminal region (ARP33059_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC38A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC38A2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC38A2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC38A2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC38A2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC38A2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SLC38A2 Antibody - N-terminal region (ARP33059_P050)
Your Rating
We found other products you might like!