ID2 Antibody - middle region (P100939_P050)

Data Sheet
 
Product Number P100939_P050
Product Page www.avivasysbio.com/id2-antibody-middle-region-p100939-p050.html
Name ID2 Antibody - middle region (P100939_P050)
Protein Size (# AA) 134 amino acids
Molecular Weight 15kDa
NCBI Gene Id 3398
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Description
Alias Symbols GIG8, ID2A, ID2H, bHLHb26
Peptide Sequence Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,J., (2008) Circ. Res. 102 (10), 1212-1221
Description of Target ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions ASB4; UBC; SUV39H2; PRMT6; KDM1A; SUV39H1; TCF12; TCF3; TSTA3; MAPK8; ID2; HSPA5; RBL2; RBL1; RB1; CDK2; USP1; MAPK3; MAPK1; E2F4; SIN3A; GATA4; NKX2-5; LRIF1; PPP1CA; RBM48; NEDD9; UNC119; MSC; TCF4; ELK3; ELK4; ELK1; PAX8; PAX5; PAX2; MYF6; MYF5; MYOG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ID2 (P100939_P050) antibody
Blocking Peptide For anti-ID2 (P100939_P050) antibody is Catalog # AAP31292 (Previous Catalog # AAPP02041)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ID2
Uniprot ID Q02363
Protein Name DNA-binding protein inhibitor ID-2
Protein Accession # NP_002157
Purification Affinity Purified
Nucleotide Accession # NM_002166
Tested Species Reactivity Human
Gene Symbol ID2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Pig
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Image 1
Human liver tissue
Rabbit Anti-ID2 Antibody
Catalog Number: P100939_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Nucleus in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human Liver
Rabbit Anti-ID2 Antibody
Catalog Number: P100939_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 3
Human Thymus
WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com