EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)

• Product Number: P100923_P050-Biotin
• Name: EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)
• Protein Size (# AA): 392 amino acids
• Molecular Weight: 40kDa
• Conjugation: Biotin
• NCBI Gene Id: 2019
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Engrailed homeobox 1
• Alias Symbols: ENDOVESLB
• Peptide Sequence: Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Atit,R., (2006) Dev. Biol. 296 (1), 164-176
• Description of Target: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: TLE1; PAX6; JUN;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-EN1 (P100923_P050-Biotin) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
• Uniprot ID: Q05925
• Protein Name: Homeobox protein engrailed-1
• Publications:

  Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene (2013). doi:10.1038/onc.2013.422 WB, ELISA, Guinea pig, Pig, Rabbit 24141779

• Protein Accession #: NP_001417
• Nucleotide Accession #: NM_001426
• Gene Symbol: EN1
• Predicted Species Reactivity: Guinea Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 93%; Rabbit: 86%
• Image 1: