SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100923_P050-Biotin
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-EN1 (P100923_P050-Biotin) antibody
Product Info
Predicted Species ReactivityGuinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Predicted Homology Based on Immunogen SequenceGuinea Pig: 93%; Rabbit: 86%
Peptide SequenceSynthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-EN1 (P100923_P050-Biotin) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
ReferenceAtit,R., (2006) Dev. Biol. 296 (1), 164-176

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene (2013). doi:10.1038/onc.2013.422 WB, ELISA, Guinea pig, Pig, Rabbit 24141779

Gene SymbolEN1
Gene Full NameEngrailed homeobox 1
Alias SymbolsENDOVESLB
NCBI Gene Id2019
Protein NameHomeobox protein engrailed-1
Description of TargetHomeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ05925
Protein Accession #NP_001417
Nucleotide Accession #NM_001426
Protein Size (# AA)392
Molecular Weight40kDa
Protein InteractionsTLE1; PAX6; JUN;
  1. What is the species homology for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Guinea Pig, Rabbit".

  2. How long will it take to receive "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    This target may also be called "ENDOVESLB" in publications.

  5. What is the shipping cost for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "EN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "EN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "EN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "EN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "EN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "EN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)
Your Rating
We found other products you might like!