Search Antibody, Protein, and ELISA Kit Solutions

EN1 Antibody - C-terminal region : Biotin (P100923_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100923_P050 Unconjugated

P100923_P050-FITC Conjugated

P100923_P050-HRP Conjugated

Predicted Species Reactivity:
Guinea Pig, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-128529 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 93%; Rabbit: 86%
Complete computational species homology data:
Anti-EN1 (P100923_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-EN1 (P100923_P050-Biotin) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025)
Datasheets/Manuals:
Printable datasheet for anti-EN1 (P100923_P050-Biotin) antibody
Target Reference:
Atit,R., (2006) Dev. Biol. 296 (1), 164-176
Publications:

Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene (2013). doi:10.1038/onc.2013.422 WB, ELISA, Guinea pig, Pig, Rabbit 24141779

Gene Symbol:
EN1
Official Gene Full Name:
Engrailed homeobox 1
Alias Symbols:
-
NCBI Gene Id:
2019
Protein Name:
Homeobox protein engrailed-1
Description of Target:
Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Q05925
Protein Accession #:
NP_001417
Nucleotide Accession #:
NM_001426
Protein Size (# AA):
392
Molecular Weight:
40kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express EN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express EN1.
Protein Interactions:
TLE1; PAX6; JUN;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...