| Product Number |
P100705_P050 |
| Product Page |
www.avivasysbio.com/tmf1-antibody-middle-region-p100705-p050.html |
| Name |
TMF1 Antibody - middle region (P100705_P050) |
| Protein Size (# AA) |
1093 amino acids |
| Molecular Weight |
123kDa |
| NCBI Gene Id |
7110 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TATA element modulatory factor 1 |
| Description |
|
| Alias Symbols |
TMF, ARA160 |
| Peptide Sequence |
Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485 |
| Description of Target |
TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP). |
| Protein Interactions |
UBC; NR3C1; GFI1B; ITSN2; KAT2B; PLK1; SMARCA4; AR; RAB6A; FER; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMF1 (P100705_P050) antibody |
| Blocking Peptide |
For anti-TMF1 (P100705_P050) antibody is Catalog # AAP31060 (Previous Catalog # AAPP01794) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMF1 |
| Uniprot ID |
P82094 |
| Protein Name |
TATA element modulatory factor |
| Sample Type Confirmation |
There is BioGPS gene expression data showing that TMF1 is expressed in MCF7 |
| Protein Accession # |
NP_009045 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007114 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human MCF-7
 | WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that TMF1 is expressed in MCF7 |
|
