Search Antibody, Protein, and ELISA Kit Solutions

TMF1 Antibody - middle region (P100705_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100705_P050-FITC Conjugated

P100705_P050-HRP Conjugated

P100705_P050-Biotin Conjugated

Gene Symbol:
TMF1
Official Gene Full Name:
TATA element modulatory factor 1
NCBI Gene Id:
7110
Protein Name:
TATA element modulatory factor
Swissprot Id:
P82094
Protein Accession #:
NP_009045
Nucleotide Accession #:
NM_007114
Alias Symbols:
ARA160, TMF
Replacement Item:
This antibody may replace item sc-25961 from Santa Cruz Biotechnology.
Description of Target:
TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).
Protein Size (# AA):
1093
Molecular Weight:
123kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express TMF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express TMF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human TMF1
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-TMF1 (P100705_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GNLEKTRSIMAEELVKLTNQNDELEEKVKEIPKLRTQLRDLDQRYNTILQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; NR3C1; GFI1B; ITSN2; KAT2B; PLK1; SMARCA4; AR; RAB6A; FER;
Blocking Peptide:
For anti-TMF1 (P100705_P050) antibody is Catalog # AAP31060 (Previous Catalog # AAPP01794)
Datasheets/Manuals:
Printable datasheet for anti-TMF1 (P100705_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that TMF1 is expressed in MCF7

Target Reference:
Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...