| Product Number |
OPCA03379 |
| Product Page |
www.avivasysbio.com/aah2-recombinant-protein-sahara-scorpion-opca03379.html |
| Name |
AaH2 Recombinant Protein (Sahara scorpion) (OPCA03379) |
| Protein Size (# AA) |
Recombinant amino acids |
| Molecular Weight |
23.3 kDa |
| Tag |
N-terminal 6xHis-SUMO-tagged |
| Host |
Androctonus australis |
| Purity |
Greater than 90% as determined by SDS-PAGE. |
| Source |
E.coli |
| Protein Range |
20-83 aa |
| Alias Symbols |
AaH II;Neurotoxin 2. |
| Peptide Sequence |
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH |
| Product Format |
Liquid or Lyophilized powder |
| Reference |
Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II.Bougis P.E., Rochat H., Smith L.A.J. Biol. Chem. 264:19259-19265(1989) |
| Description of Target |
Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels (PubMed:23685008). It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM) (PubMed:12911331), as well as on human neuronal Nav1.7/SCN9A (EC(50)=6.8 nM) (PubMed:23685008). This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses (PubMed:23685008). |
| Reconstitution and Storage |
-20°C or -80°C |
| Protein Sequence |
VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH |
| Datasheets/Manuals |
Printable datasheet for AaH2 Recombinant Protein (Sahara scorpion) (OPCA03379) (OPCA03379) |
| Additional Information |
Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals. |
| Formulation |
20 mM Tris-HCl based buffer, pH 8.0 |
| Storage Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Uniprot ID |
P01484 |
| Protein Name |
Alpha-mammal toxin AaH2 |
| Predicted Species Reactivity |
Androctonus australis |
| Image 1 | Protein SDS-PAGE
 | AaH2 Recombinant Protein (Androctonus australis) (OPCA03379) in SDS-PAGE showing the molecular weight of approximately 23.25 kDa. |
|
|
