AaH2 Recombinant Protein (Sahara scorpion) (OPCA03379)

Catalog No: OPCA03379

AaH2 Recombinant Protein (Androctonus australis) (OPCA03379) in SDS-PAGE showing the molecular weight of approximately 23.25 kDa.

Product Info

• Predicted Species Reactivity: Androctonus australis
• Product Format: Liquid or Lyophilized powder
• Host: Androctonus australis
• Additional Information: Relevance: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against mammals.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
• Protein Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 20-83 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II.Bougis P.E., Rochat H., Smith L.A.J. Biol. Chem. 264:19259-19265(1989)
• Alias Symbols: AaH II, Neurotoxin 2.
• Protein Name: Alpha-mammal toxin AaH2
• Description of Target: Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The toxin principally slows the inactivation process of TTX-sensitive sodium channels (PubMed:23685008). It is active on rat brain Nav1.2/SCN2A sodium channel (EC(50)=2.6 nM) and on rat skeletal muscle Nav1.4/SCN4A sodium channel (EC(50)=2.2 nM) (PubMed:12911331), as well as on human neuronal Nav1.7/SCN9A (EC(50)=6.8 nM) (PubMed:23685008). This toxin is active against mammals. In vivo, intraplantar injection into mice induces spontaneous pain responses (PubMed:23685008).
• Uniprot ID: P01484
• Protein Size (# AA): Full Length of Mature Protein
• Molecular Weight: 23.3 kda