FOXO1A Antibody (Phospho-Ser329) (OAAF07382)

• Product Number: OAAF07382
• Name: FOXO1A Antibody (Phospho-Ser329) (OAAF07382)
• Molecular Weight: 69 kDa
• Isotype: IgG
• NCBI Gene Id: 2308
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1 mg/ml
• Gene Full Name: forkhead box O1
• Alias Symbols: FKH1;FKHR;forkhead box protein O1;forkhead box protein O1A;Forkhead in rhabdomyosarcoma;forkhead, Drosophila, homolog of, in rhabdomyosarcoma;FOXO1A.
• Peptide Sequence: Synthetic peptide located within the following region: WPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVH
• Product Format: Liquid (without Mg²⁺ and Ca²⁺) (pH 7.4), 150mM NaCl, 0.02% sodium azide and 50% glycerol
• Description of Target: Transcription factor that is the main target of insulin signaling and regulates metabolic homeostasis in response to oxidative stress. Binds to the insulin response element (IRE) with consensus sequence 5'-TT[G/A]TTTTG-3' and the related Daf-16 family binding element (DBE) with consensus sequence 5'-TT[G/A]TTTAC-3'. Activity suppressed by insulin. Main regulator of redox balance and osteoblast numbers and controls bone mass. Orchestrates the endocrine function of the skeleton in regulating glucose metabolism. Acts synergistically with ATF4 to suppress osteocalcin/BGLAP activity, increasing glucose levels and triggering glucose intolerance and insulin insensitivity. Also suppresses the transcriptional activity of RUNX2, an upstream activator of osteocalcin/BGLAP. In hepatocytes, promotes gluconeogenesis by acting together with PPARGC1A and CEBPA to activate the expression of genes such as IGFBP1, G6PC and PCK1. Important regulator of cell death acting downstream of CDK1, PKB/AKT1 and STK4/MST1. Promotes neural cell death. Mediates insulin action on adipose tissue. Regulates the expression of adipogenic genes such as PPARG during preadipocyte differentiation and, adipocyte size and adipose tissue-specific gene expression in response to excessive calorie intake. Regulates the transcriptional activity of GADD45A and repair of nitric oxide-damaged DNA in beta-cells. Required for the autophagic cell death induction in response to starvation or oxidative stress in a transcription-independent manner. Mediates the function of MLIP in cardiomyocytes hypertrophy and cardiac remodeling (By similarity).
• Reconstitution and Storage: -20°C
• Specificity: FOXO1A (Phospho-Ser329) Antibody detects endogenous levels of FOXO1A only when phosphorylated at Ser329.
• Additional Information: Modification Sites: H:S329, M: S326, R: S323
• Application Info: WB: 1:500~1000
  IHC: 1:50~100
  ELISA: 1:1000
• Immunogen: The antiserum was produced against synthesized peptide derived from human FOXO1A around the phosphorylation site of Ser329.
• Uniprot ID: Q12778
• Protein Name: Forkhead box protein O1
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Gene Symbol: FOXO1
• Predicted Species Reactivity: Human|Mouse|Rat
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Image 1: HeLa cells
  
  Western blot analysis of lysates from HeLa cells treated with Serum 20% 15', using FOXO1A (Phospho-Ser329) Antibody. The lane on the right is blocked with the phospho peptide.
• Image 2: Paraffin-embedded human breast carcinoma
  
  Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using FOXO1A (Phospho-Ser329) Antibody. The picture on the right is blocked with the phospho peptide.