GABRA2 Antibody - middle region (AVARP13026_T100)

Data Sheet
 
Product Number AVARP13026_T100
Product Page www.avivasysbio.com/gabra2-antibody-middle-region-avarp13026-t100.html
Name GABRA2 Antibody - middle region (AVARP13026_T100)
Protein Size (# AA) 451 amino acids
Molecular Weight 51kDa
Subunit alpha-2
NCBI Gene Id 2555
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, alpha 2
Alias Symbols DEE78, EIEE78
Peptide Sequence Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tian,H., et al., Brain Res. Mol. Brain Res. 137 (1-2), 174-183 (2005)
Description of Target GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Protein Interactions UBQLN1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRA2 (AVARP13026_T100) antibody
Blocking Peptide For anti-GABRA2 (AVARP13026_T100) antibody is Catalog # AAP30684 (Previous Catalog # AAPP01341)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GABRA2
Uniprot ID P47869
Protein Name Gamma-aminobutyric acid receptor subunit alpha-2
Publications

Kitayama, T. et al. Phospholipase C-related but catalytically inactive protein modulates pain behavior in a neuropathic pain model in mice. Mol. Pain 9, 23 (2013). 23639135

Protein Accession # NP_000798
Purification Protein A purified
Nucleotide Accession # NM_000807
Tested Species Reactivity Human
Gene Symbol GABRA2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-GABRA2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Human Jurkat Whole Cell
Host: Rabbit
Target Name: GABRA2
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com