Search Antibody, Protein, and ELISA Kit Solutions

GABRA2 Antibody - middle region (AVARP13026_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP13026_T100-FITC Conjugated

AVARP13026_T100-HRP Conjugated

AVARP13026_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133602 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human GABRA2
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-GABRA2 (AVARP13026_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-GABRA2 (AVARP13026_T100) antibody is Catalog # AAP30684 (Previous Catalog # AAPP01341)
Printable datasheet for anti-GABRA2 (AVARP13026_T100) antibody
Target Reference:
Tian,H., et al., Brain Res. Mol. Brain Res. 137 (1-2), 174-183 (2005)

Kitayama, T. et al. Phospholipase C-related but catalytically inactive protein modulates pain behavior in a neuropathic pain model in mice. Mol. Pain 9, 23 (2013). WB, Cow, Dog, Horse, Human, Mouse, Rabbit, Rat 23639135

Gene Symbol:
Official Gene Full Name:
Gamma-aminobutyric acid (GABA) A receptor, alpha 2
NCBI Gene Id:
Protein Name:
Gamma-aminobutyric acid receptor subunit alpha-2
Description of Target:
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GABRA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GABRA2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...