| Product Number |
AVARP13011_P050 |
| Product Page |
www.avivasysbio.com/chm-antibody-n-terminal-region-avarp13011-p050.html |
| Name |
CHM Antibody - N-terminal region (AVARP13011_P050) |
| Protein Size (# AA) |
653 amino acids |
| Molecular Weight |
73kDa |
| NCBI Gene Id |
1121 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Choroideremia (Rab escort protein 1) |
| Alias Symbols |
TCD, GGTA, REP-1, DXS540, HSD-32 |
| Peptide Sequence |
Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Fujita,Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (4), 1315-1321 |
| Description of Target |
CHM binds unprenylated Rab proteins, presents it to the catalytic Rab GGTase dimer, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane.The choroideremia gene encodes for a protein, the Rab escort protein-1 (REP1), which is involved in membrane trafficking.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; RAB1B; RAB32; RAB14; RAB3D; RAB7A; RAB18; RAB5B; RAB6A; RAB4A; RAB3B; RAB3A; RAB5A; RAB1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHM (AVARP13011_P050) antibody |
| Blocking Peptide |
For anti-CHM (AVARP13011_P050) antibody is Catalog # AAP30666 (Previous Catalog # AAPP01323) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHM |
| Uniprot ID |
P24386 |
| Protein Name |
Rab proteins geranylgeranyltransferase component A 1 |
| Protein Accession # |
NP_000381 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000390 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHM |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 80%; Human: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-CHM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Thymus |
|
|
