| Product Number |
AVARP09054_P050 |
| Product Page |
www.avivasysbio.com/aifm2-antibody-middle-region-avarp09054-p050.html |
| Name |
AIFM2 Antibody - middle region (AVARP09054_P050) |
| Protein Size (# AA) |
373 amino acids |
| Molecular Weight |
40kDa |
| NCBI Gene Id |
84883 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Apoptosis-inducing factor, mitochondrion-associated, 2 |
| Alias Symbols |
AMID, FSP1, PRG3 |
| Peptide Sequence |
Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gong,M., (2007) J. Biol. Chem. 282 (41), 30331-30340 |
| Description of Target |
AIFM2 has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. |
| Protein Interactions |
TP53; UBC; MYC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-AIFM2 (AVARP09054_P050) antibody |
| Additional Information |
IHC Information: Placenta |
| Blocking Peptide |
For anti-AIFM2 (AVARP09054_P050) antibody is Catalog # AAP30552 (Previous Catalog # AAPP01204) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AIFM2 |
| Uniprot ID |
Q9BRQ8 |
| Protein Name |
Apoptosis-inducing factor 2 |
| Protein Accession # |
NP_116186 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032797 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
AIFM2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 80%; Rabbit: 93%; Rat: 80% |
| Image 1 | Human brain
 | WB Suggested Anti-AIFM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human brain |
| | Image 2 | Placenta
 | Placenta |
|
|
