SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: AVARP09054_P050
Price: $0.00
SKU
AVARP09054_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-AIFM2 (AVARP09054_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Placenta
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AIFM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 80%; Rabbit: 93%; Rat: 80%
Peptide SequenceSynthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
Concentration0.5 mg/ml
Blocking PeptideFor anti-AIFM2 (AVARP09054_P050) antibody is Catalog # AAP30552 (Previous Catalog # AAPP01204)
ReferenceGong,M., (2007) J. Biol. Chem. 282 (41), 30331-30340
Description
Gene SymbolAIFM2
Gene Full NameApoptosis-inducing factor, mitochondrion-associated, 2
Alias SymbolsAMID, FSP1, PRG3
NCBI Gene Id84883
Protein NameApoptosis-inducing factor 2
Description of TargetAIFM2 has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells.
Uniprot IDQ9BRQ8
Protein Accession #NP_116186
Nucleotide Accession #NM_032797
Protein Size (# AA)373
Molecular Weight40kDa
Protein InteractionsTP53; UBC; MYC;
  1. What is the species homology for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit".

  2. How long will it take to receive "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AIFM2 Antibody - middle region (AVARP09054_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    This target may also be called "AMID, FSP1, PRG3" in publications.

  5. What is the shipping cost for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AIFM2 Antibody - middle region (AVARP09054_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AIFM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AIFM2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AIFM2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AIFM2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AIFM2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AIFM2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:AIFM2 Antibody - middle region (AVARP09054_P050)
Your Rating
We found other products you might like!