| Product Number |
ARP96667_P050 |
| Product Page |
www.avivasysbio.com/mrgpra5-antibody-n-terminal-region-arp96667-p050.html |
| Name |
MRGPRA5 Antibody - N-terminal region (ARP96667_P050) |
| Protein Size (# AA) |
304 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
404235 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
MAS-related GPR, member A5 |
| Alias Symbols |
Mrg, MrgA5 |
| Peptide Sequence |
Synthetic peptide located within the following region: DKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYIL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Orphan receptor. May be a receptor for RFamide-family neuropeptides such as NPFF and NPAF, which are analgesic in vivo. May regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity). |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MRGPRA5 (ARP96667_P050) antibody |
| Blocking Peptide |
For anti-MRGPRA5 (ARP96667_P050) antibody is Catalog # ARP96667_P050 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MRGPRA5 |
| Uniprot ID |
Q91ZC7 |
| Protein Name |
Mas-related G-protein coupled receptor member A5 |
| Protein Accession # |
NP_997417.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_207534.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MRGPRA5 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Skeletal Muscle
 | Host: Rabbit
Target Name: MRGPRA5
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml |
|
|
