Search Antibody, Protein, and ELISA Kit Solutions

MRGPRA5 Antibody - N-terminal region (ARP96667_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MRGPRA5
Official Gene Full Name:
MAS-related GPR, member A5
NCBI Gene Id:
404235
Protein Name:
Mas-related G-protein coupled receptor member A5
Swissprot Id:
Q91ZC7
Protein Accession #:
NP_997417.1
Nucleotide Accession #:
NM_207534.1
Alias Symbols:
MrgA5
Description of Target:
Orphan receptor. May be a receptor for RFamide-family neuropeptides such as NPFF and NPAF, which are analgesic in vivo. May regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).
Protein Size (# AA):
304
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRGPRA5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRGPRA5.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MRGPRA5
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: DKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MRGPRA5 (ARP96667_P050) antibody is Catalog # ARP96667_P050
Datasheets/Manuals:
Printable datasheet for anti-MRGPRA5 (ARP96667_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...