Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP96667_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MRGPRA5 Antibody - N-terminal region (ARP96667_P050)

Catalog#: ARP96667_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse MRGPRA5
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: DKPLWKYGHLDSDPKLMIIIFRLVGMTGNAIVFWLLGFSLHRNAFSVYIL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MRGPRA5 (ARP96667_P050) antibody is Catalog # ARP96667_P050
Datasheets/Manuals Printable datasheet for anti-MRGPRA5 (ARP96667_P050) antibody
Gene Symbol MRGPRA5
Official Gene Full Name MAS-related GPR, member A5
Alias Symbols MrgA5
NCBI Gene Id 404235
Protein Name Mas-related G-protein coupled receptor member A5
Description of Target Orphan receptor. May be a receptor for RFamide-family neuropeptides such as NPFF and NPAF, which are analgesic in vivo. May regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).
Swissprot Id Q91ZC7
Protein Accession # NP_997417.1
Nucleotide Accession # NM_207534.1
Protein Size (# AA) 304
Molecular Weight 35 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MRGPRA5.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MRGPRA5.
  1. What is the species homology for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    This target may also be called "MrgA5" in publications.

  5. What is the shipping cost for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRGPRA5 Antibody - N-terminal region (ARP96667_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MRGPRA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRGPRA5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRGPRA5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRGPRA5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRGPRA5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRGPRA5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRGPRA5 Antibody - N-terminal region (ARP96667_P050)
Your Rating