| Product Number |
ARP94303_P050 |
| Product Page |
www.avivasysbio.com/prelid1-antibody-n-terminal-region-arp94303-p050.html |
| Name |
PRELID1 Antibody - N-terminal region (ARP94303_P050) |
| Protein Size (# AA) |
217 amino acids |
| Molecular Weight |
23 kDa |
| NCBI Gene Id |
66494 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
PRELI domain containing 1 |
| Alias Symbols |
Preli, 2610524G07Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: QSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity). |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRELID1 (ARP94303_P050) antibody |
| Blocking Peptide |
For anti-PRELID1 (ARP94303_P050) antibody is Catalog # AAP94303 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PRELID1 |
| Uniprot ID |
Q8R107 |
| Protein Name |
PRELI domain-containing protein 1, mitochondrial |
| Protein Accession # |
NP_079872.4 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_025596.5 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
PRELID1 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Testis
 | Host: Rabbit
Target Name: PRELID1
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml |
|
|
