Search Antibody, Protein, and ELISA Kit Solutions

PRELID1 Antibody - N-terminal region (ARP94303_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
PRELI domain containing 1
NCBI Gene Id:
Protein Name:
PRELI domain-containing protein 1, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Preli, 2610524G07Rik
Description of Target:
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity).
Protein Size (# AA):
Molecular Weight:
23 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRELID1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRELID1.
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PRELID1
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: QSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRELID1 (ARP94303_P050) antibody is Catalog # AAP94303
Printable datasheet for anti-PRELID1 (ARP94303_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...