PRELID1 Antibody - N-terminal region (ARP94303_P050)

Catalog No: ARP94303_P050

Host: Rabbit
Target Name: PRELID1
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PRELID1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRELID1 (ARP94303_P050) antibody is Catalog # AAP94303

Target Info

• Gene Symbol: PRELID1
• Gene Full Name: PRELI domain containing 1
• Alias Symbols: Preli, 2610524G07Rik
• NCBI Gene Id: 66494
• Protein Name: PRELI domain-containing protein 1, mitochondrial
• Description of Target: Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity).
• Uniprot ID: Q8R107
• Protein Accession #: NP_079872.4
• Nucleotide Accession #: NM_025596.5
• Protein Size (# AA): 217
• Molecular Weight: 23 kDa