Search Antibody, Protein, and ELISA Kit Solutions

PRELID1 Antibody - N-terminal region (ARP94303_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
PRELID1
Official Gene Full Name:
PRELI domain containing 1
NCBI Gene Id:
66494
Protein Name:
PRELI domain-containing protein 1, mitochondrial
Swissprot Id:
Q8R107
Protein Accession #:
NP_079872.4
Nucleotide Accession #:
NM_025596.5
Alias Symbols:
Preli, 2610524G07Rik
Description of Target:
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Regulates the mitochondrial apoptotic pathway in primary Th cells. Regulates Th cell differentiation by down-regulating STAT6 thereby reducing IL-4-induced Th2 cell number. May be important for the development of vital and immunocompetent organs (By similarity).
Protein Size (# AA):
217
Molecular Weight:
23 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRELID1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRELID1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse PRELID1
Peptide Sequence:
Synthetic peptide located within the following region: QSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLT
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRELID1 (ARP94303_P050) antibody is Catalog # AAP94303
Datasheets/Manuals:
Printable datasheet for anti-PRELID1 (ARP94303_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...