| Product Number |
ARP94127_P050 |
| Product Page |
www.avivasysbio.com/degs2-antibody-c-terminal-region-arp94127-p050.html |
| Name |
DEGS2 Antibody - C-terminal region (ARP94127_P050) |
| Protein Size (# AA) |
323 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
70059 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
delta(4)-desaturase, sphingolipid 2 |
| Alias Symbols |
Des, DES2, AI852933, 2210008A03Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Bifunctional enzyme which acts as both a sphingolipid delta4-desaturase and a sphingolipid C4-monooxygenase. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DEGS2 (ARP94127_P050) antibody |
| Blocking Peptide |
For anti-DEGS2 (ARP94127_P050) antibody is Catalog # AAP94127 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2 |
| Uniprot ID |
Q8R2F2 |
| Protein Name |
sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 |
| Protein Accession # |
NP_001164473.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001171002.1 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
DEGS2 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Kidney
 | Host: Rabbit
Target Name: DEGS2
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml |
|
|
