Search Antibody, Protein, and ELISA Kit Solutions

DEGS2 Antibody - C-terminal region (ARP94127_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DEGS2
Official Gene Full Name:
delta(4)-desaturase, sphingolipid 2
NCBI Gene Id:
70059
Protein Name:
sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
Swissprot Id:
Q8R2F2
Protein Accession #:
NP_001164473.1
Nucleotide Accession #:
NM_001171002.1
Alias Symbols:
DES2, AI852933, 2210008A03Rik
Description of Target:
Bifunctional enzyme which acts as both a sphingolipid delta4-desaturase and a sphingolipid C4-monooxygenase.
Protein Size (# AA):
323
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DEGS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DEGS2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DEGS2 (ARP94127_P050) antibody is Catalog # AAP94127
Datasheets/Manuals:
Printable datasheet for anti-DEGS2 (ARP94127_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...