| Product Number |
ARP94047_P050 |
| Product Page |
www.avivasysbio.com/mgarp-antibody-n-terminal-region-arp94047-p050.html |
| Name |
MGARP Antibody - N-terminal region (ARP94047_P050) |
| Protein Size (# AA) |
283 amino acids |
| Molecular Weight |
30 kDa |
| NCBI Gene Id |
67749 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
mitochondria localized glutamic acid rich protein |
| Alias Symbols |
Osap, Qsap, HUMMR, CESP-1, AI195347, 4930583H14Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: PPGPAPLGKDASLRRMSSRKFPGTSGSNMIYYLVVGVTVSAGGYYTYKAL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MGARP (ARP94047_P050) antibody |
| Blocking Peptide |
For anti-MGARP (ARP94047_P050) antibody is Catalog # AAP94047 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N region of mouse OSAP |
| Uniprot ID |
Q8VI64 |
| Protein Name |
protein MGARP |
| Protein Accession # |
NP_080634.2 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_026358.3 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
MGARP |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Small Intestine
 | Host: Rabbit
Target Name: OSAP
Sample Tissue: Mouse Small Intestine lysates
Antibody Dilution: 1ug/ml |
|
|
