Search Antibody, Protein, and ELISA Kit Solutions

MGARP Antibody - N-terminal region (ARP94047_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MGARP
Official Gene Full Name:
mitochondria localized glutamic acid rich protein
NCBI Gene Id:
67749
Protein Name:
protein MGARP
Swissprot Id:
Q8VI64
Protein Accession #:
NP_080634.2
Nucleotide Accession #:
NM_026358.3
Alias Symbols:
Osap, Qsap, HUMMR, CESP-1, AI195347, 4930583H14Rik
Protein Size (# AA):
283
Molecular Weight:
30 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MGARP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MGARP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N region of mouse OSAP
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: PPGPAPLGKDASLRRMSSRKFPGTSGSNMIYYLVVGVTVSAGGYYTYKAL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MGARP (ARP94047_P050) antibody is Catalog # AAP94047
Datasheets/Manuals:
Printable datasheet for anti-MGARP (ARP94047_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...