| Product Number |
ARP89853_P050 |
| Product Page |
www.avivasysbio.com/pim2-antibody-middle-region-arp89853-p050.html |
| Name |
PIM2 Antibody - middle region (ARP89853_P050) |
| Protein Size (# AA) |
370 amino acids |
| Molecular Weight |
40 kDa |
| NCBI Gene Id |
18715 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
proviral integration site 2 |
| Alias Symbols |
Pim, Pim-2, DXCch3 |
| Peptide Sequence |
Synthetic peptide located within the following region: ENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PIM2 (ARP89853_P050) antibody |
| Blocking Peptide |
For anti-PIM2 (ARP89853_P050) antibody is Catalog # AAP89853 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse PIM2 |
| Uniprot ID |
Q62070 |
| Protein Name |
serine/threonine-protein kinase pim-2 |
| Protein Accession # |
NP_613072.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_138606.2 |
| Gene Symbol |
PIM2 |
| Predicted Species Reactivity |
Mouse |
| Application |
WB |
| Image 1 | Mouse Small Intestine
 | Host: Rabbit
Target Name: PIM2
Sample Tissue: Mouse Small Intestine lysates
Antibody Dilution: 1ug/ml |
|
|
