Search Antibody, Protein, and ELISA Kit Solutions

PIM2 Antibody - middle region (ARP89853_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PIM2
Official Gene Full Name:
proviral integration site 2
NCBI Gene Id:
18715
Protein Name:
serine/threonine-protein kinase pim-2
Swissprot Id:
Q62070
Protein Accession #:
NP_613072.1
Nucleotide Accession #:
NM_138606.2
Alias Symbols:
Pim-2, DXCch3
Description of Target:
Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulation of cap-dependent protein translation and through survival signaling by phosphorylation of a pro-apoptotic protein, BAD. Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerted by PIM2 might explain partly the strong synergism between these 2 oncogenes in tumorigenesis. Regulates cap-dependent protein translation in a mammalian target of rapamycin complex 1 (mTORC1)-independent manner and in parallel to the PI3K-Akt pathway. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl-X(L)/BCL2L1. Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappa-B kinase/NF-kappa-B cascade; this process requires phosphorylation of MAP3K8/COT. Promotes growth factor-independent proliferation by phosphorylation of cell cycle factors such as CDKN1A and CDKN1B. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.
Protein Size (# AA):
370
Molecular Weight:
40 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of mouse PIM2
Predicted Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: ENILIDLCRGSIKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PIM2 (ARP89853_P050) antibody is Catalog # AAP89853
Datasheets/Manuals:
Printable datasheet for anti-PIM2 (ARP89853_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...