PRKACA Antibody - N-terminal region (ARP88687_P050)

• Product Number: ARP88687_P050
• Name: PRKACA Antibody - N-terminal region (ARP88687_P050)
• Protein Size (# AA): 351 amino acids
• Molecular Weight: 41 kDa
• NCBI Gene Id: 5566
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: protein kinase cAMP-activated catalytic subunit alpha
• Alias Symbols: CAFD1, PKACA, PPNAD4
• Peptide Sequence: Synthetic peptide located within the following region: FLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRKACA (ARP88687_P050) antibody is Catalog # AAP88687
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA
• Uniprot ID: P17612
• Protein Name: cAMP-dependent protein kinase catalytic subunit alpha
• Protein Accession #: NP_001291278.1
• Purification: Affinity purified
• Nucleotide Accession #: NM_001304349.1
• Tested Species Reactivity: Human
• Gene Symbol: PRKACA
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Mesenchymoma Tumor
  
  Host: Rabbit
  Target Name: PRKACA
  Sample Tissue: Human Mesenchymoma Tumor lysates
  Antibody Dilution: 1ug/ml