Search Antibody, Protein, and ELISA Kit Solutions

PRKACA Antibody - N-terminal region (ARP88687_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PRKACA
Official Gene Full Name:
protein kinase cAMP-activated catalytic subunit alpha
NCBI Gene Id:
5566
Protein Name:
cAMP-dependent protein kinase catalytic subunit alpha
Swissprot Id:
P17612
Protein Accession #:
NP_001291278.1
Nucleotide Accession #:
NM_001304349.1
Alias Symbols:
PKACA, PPNAD4
Description of Target:
This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushing's syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.
Protein Size (# AA):
351
Molecular Weight:
41 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKACA.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKACA.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACA
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: FLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKACA (ARP88687_P050) antibody is Catalog # AAP88687
Datasheets/Manuals:
Printable datasheet for anti-PRKACA (ARP88687_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...