BCL3 Antibody - C-terminal region (ARP87477_P050)

• Product Number: ARP87477_P050
• Name: BCL3 Antibody - C-terminal region (ARP87477_P050)
• Protein Size (# AA): 454 amino acids
• Molecular Weight: 49 kDa
• NCBI Gene Id: 602
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: B-cell CLL/lymphoma 3
• Alias Symbols: BCL4, D19S37
• Peptide Sequence: Synthetic peptide located within the following region: SPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BCL3 (ARP87477_P050) antibody is Catalog # AAP87477
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BCL3
• Uniprot ID: P20749
• Protein Name: B-cell lymphoma 3 protein
• Protein Accession #: NP_005169.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_005178.4
• Tested Species Reactivity: Human
• Gene Symbol: BCL3
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human A549 Whole Cell
  
  Host: Rabbit
  Target Name: BCL3
  Sample Tissue: Human A549 Whole Cell lysates
  Antibody Dilution: 1ug/ml