Search Antibody, Protein, and ELISA Kit Solutions

BCL3 Antibody - C-terminal region (ARP87477_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
BCL3
Official Gene Full Name:
B-cell CLL/lymphoma 3
NCBI Gene Id:
602
Protein Name:
B-cell lymphoma 3 protein
Swissprot Id:
P20749
Protein Accession #:
NP_005169.2
Nucleotide Accession #:
NM_005178.4
Alias Symbols:
BCL4, D19S37
Description of Target:
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those found in I kappa B proteins. This protein functions as a transcriptional co-activator that activates through its association with NF-kappa B homodimers. The expression of this gene can be induced by NF-kappa B, which forms a part of the autoregulatory loop that controls the nuclear residence of p50 NF-kappa B.
Protein Size (# AA):
454
Molecular Weight:
49 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BCL3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BCL3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human BCL3
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SPSQSPPRDPPGFPMAPPNFFLPSPSPPAFLPFAGVLRGPGRPVPPSPAP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-BCL3 (ARP87477_P050) antibody is Catalog # AAP87477
Datasheets/Manuals:
Printable datasheet for anti-BCL3 (ARP87477_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...