| Product Number |
ARP87444_P050 |
| Product Page |
www.avivasysbio.com/hip1-antibody-n-terminal-region-arp87444-p050.html |
| Name |
HIP1 Antibody - N-terminal region (ARP87444_P050) |
| Protein Size (# AA) |
1037 amino acids |
| Molecular Weight |
114 kDa |
| NCBI Gene Id |
3092 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
huntingtin interacting protein 1 |
| Alias Symbols |
SHON, HIP-I, ILWEQ, SHONbeta, SHONgamma |
| Peptide Sequence |
Synthetic peptide located within the following region: KMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The product of this gene is a membrane-associated protein that functions in clathrin-mediated endocytosis and protein trafficking within the cell. The encoded protein binds to the huntingtin protein in the brain; this interaction is lost in Huntington's disease. Alternative splicing results in multiple transcript variants. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HIP1 (ARP87444_P050) antibody |
| Blocking Peptide |
For anti-HIP1 (ARP87444_P050) antibody is Catalog # AAP87444 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HIP1 |
| Uniprot ID |
O00291 |
| Protein Name |
huntingtin-interacting protein 1 |
| Protein Accession # |
NP_001230127.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001243198.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HIP1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human Hela Whole Cell
 | Host: Rabbit
Target Name: HIP1
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
