Search Antibody, Protein, and ELISA Kit Solutions

HIP1 Antibody - N-terminal region (ARP87444_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
HIP1
Official Gene Full Name:
huntingtin interacting protein 1
NCBI Gene Id:
3092
Protein Name:
huntingtin-interacting protein 1
Swissprot Id:
O00291
Protein Accession #:
NP_001230127.1
Nucleotide Accession #:
NM_001243198.2
Alias Symbols:
SHON, HIP-I, ILWEQ, SHONbeta, SHONgamma
Description of Target:
The product of this gene is a membrane-associated protein that functions in clathrin-mediated endocytosis and protein trafficking within the cell. The encoded protein binds to the huntingtin protein in the brain; this interaction is lost in Huntington's disease. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
1037
Molecular Weight:
114 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HIP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HIP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human HIP1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KMEYHTKNPRFPGNLQMSDRQLDEAGESDVNNFFQLTVEMFDYLECELNL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HIP1 (ARP87444_P050) antibody is Catalog # AAP87444
Datasheets/Manuals:
Printable datasheet for anti-HIP1 (ARP87444_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...