| Product Number |
ARP87195_P050 |
| Product Page |
www.avivasysbio.com/cd81-antibody-middle-region-arp87195-p050.html |
| Name |
CD81 Antibody - middle region (ARP87195_P050) |
| Protein Size (# AA) |
236 amino acids |
| Molecular Weight |
25 kDa |
| NCBI Gene Id |
975 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
CD81 molecule |
| Alias Symbols |
S5.7, CVID6, TAPA1, TSPAN28 |
| Peptide Sequence |
Synthetic peptide located within the following region: WGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CD81 (ARP87195_P050) antibody |
| Blocking Peptide |
For anti-CD81 (ARP87195_P050) antibody is Catalog # AAP87195 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CD81 |
| Uniprot ID |
P60033 |
| Protein Name |
CD81 antigen |
| Protein Accession # |
NP_001284578.1 |
| Purification |
Affinity purified |
| Nucleotide Accession # |
NM_001297649.1 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CD81 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Image 1 | Human A549 Whole Cell
 | Host: Rabbit
Target Name: CD81
Sample Tissue: Human A549 Whole Cell lysates
Antibody Dilution: 1ug/ml |
|
|
