Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP87195_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

CD81 Antibody - middle region (ARP87195_P050)

Catalog#: ARP87195_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CD81
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: WGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-CD81 (ARP87195_P050) antibody is Catalog # AAP87195
Datasheets/ManualsPrintable datasheet for anti-CD81 (ARP87195_P050) antibody
Gene SymbolCD81
Official Gene Full NameCD81 molecule
Alias SymbolsS5.7; CVID6; TAPA1; TSPAN28
NCBI Gene Id975
Protein NameCD81 antigen
Description of TargetThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot IdP60033
Protein Accession #NP_001284578.1
Nucleotide Accession #NM_001297649.1
Protein Size (# AA)236
Molecular Weight25 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express CD81.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express CD81.
Write Your Own Review
You're reviewing:CD81 Antibody - middle region (ARP87195_P050)
Your Rating
Aviva Tips and Tricks
Aviva Live Chat
Aviva Travel Grant
Aviva Tissue Tool