Search Antibody, Protein, and ELISA Kit Solutions

CD81 Antibody - middle region (ARP87195_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
CD81
Official Gene Full Name:
CD81 molecule
NCBI Gene Id:
975
Protein Name:
CD81 antigen
Swissprot Id:
P60033
Protein Accession #:
NP_001284578.1
Nucleotide Accession #:
NM_001297649.1
Alias Symbols:
S5.7; CVID6; TAPA1; TSPAN28
Description of Target:
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This protein appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. This gene is localized in the tumor-suppressor gene region and thus it is a candidate gene for malignancies. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
236
Molecular Weight:
25 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CD81.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CD81.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CD81
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: WGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-CD81 (ARP87195_P050) antibody is Catalog # AAP87195
Datasheets/Manuals:
Printable datasheet for anti-CD81 (ARP87195_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...