LPAR1 Antibody - C-terminal region (ARP84602_P050)

Data Sheet
 
Product Number ARP84602_P050
Product Page www.avivasysbio.com/lpar1-antibody-c-terminal-region-arp84602-p050.html
Product Name LPAR1 Antibody - C-terminal region (ARP84602_P050)
Size 100 ul
Gene Symbol LPAR1
Alias Symbols EDG2, LPA1, VZG1, GPR26, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3
Protein Size (# AA) 364 amino acids
Molecular Weight 40 kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1902
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name lysophosphatidic acid receptor 1
Peptide Sequence Synthetic peptide located within the following region: NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV
Description of Target The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-LPAR1 (ARP84602_P050) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 24 hours delivery International: 3-5 business days
Blocking Peptide For anti-LPAR1 (ARP84602_P050) antibody is Catalog # AAP84602
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LPAR1.
Swissprot Id Q92633
Protein Name lysophosphatidic acid receptor 1
Protein Accession # NP_001392.2
Purification Affinity purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LPAR1.
Nucleotide Accession # NM_001401.3
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Image 1
Human Testicular Tumor
Host: Rabbit
Target Name: LPAR1
Sample Tissue: Human Testicular Tumor lysates
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com