LPAR1 Antibody - C-terminal region (ARP84602_P050)

• Product Number: ARP84602_P050
• Name: LPAR1 Antibody - C-terminal region (ARP84602_P050)
• Protein Size (# AA): 364 amino acids
• Molecular Weight: 40 kDa
• NCBI Gene Id: 1902
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: lysophosphatidic acid receptor 1
• Alias Symbols: EDG2, LPA1, VZG1, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3
• Peptide Sequence: Synthetic peptide located within the following region: NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LPAR1 (ARP84602_P050) antibody is Catalog # AAP84602
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1
• Uniprot ID: Q92633
• Protein Name: lysophosphatidic acid receptor 1
• Protein Accession #: NP_001392.2
• Purification: Affinity purified
• Nucleotide Accession #: NM_001401.3
• Tested Species Reactivity: Human
• Gene Symbol: LPAR1
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human Testicular Tumor
  
  Host: Rabbit
  Target Name: LPAR1
  Sample Tissue: Human Testicular Tumor lysates
  Antibody Dilution: 1ug/ml