Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP84602_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

LPAR1 Antibody - C-terminal region (ARP84602_P050)

Catalog#: ARP84602_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-LPAR1 (ARP84602_P050) antibody is Catalog # AAP84602
Datasheets/Manuals Printable datasheet for anti-LPAR1 (ARP84602_P050) antibody
Gene Symbol LPAR1
Official Gene Full Name lysophosphatidic acid receptor 1
Alias Symbols EDG2, LPA1, VZG1, GPR26, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3
NCBI Gene Id 1902
Protein Name lysophosphatidic acid receptor 1
Description of Target The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene
Swissprot Id Q92633
Protein Accession # NP_001392.2
Nucleotide Accession # NM_001401.3
Protein Size (# AA) 364
Molecular Weight 40 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LPAR1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LPAR1.
  1. What is the species homology for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "LPAR1 Antibody - C-terminal region (ARP84602_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    This target may also be called "EDG2, LPA1, VZG1, GPR26, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3" in publications.

  5. What is the shipping cost for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LPAR1 Antibody - C-terminal region (ARP84602_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "LPAR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LPAR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LPAR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LPAR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LPAR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LPAR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LPAR1 Antibody - C-terminal region (ARP84602_P050)
Your Rating
We found other products you might like!