Search Antibody, Protein, and ELISA Kit Solutions

LPAR1 Antibody - C-terminal region (ARP84602_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
LPAR1
Official Gene Full Name:
lysophosphatidic acid receptor 1
NCBI Gene Id:
1902
Protein Name:
lysophosphatidic acid receptor 1
Swissprot Id:
Q92633
Protein Accession #:
NP_001392.2
Nucleotide Accession #:
NM_001401.3
Alias Symbols:
EDG2, LPA1, VZG1, GPR26, edg-2, vzg-1, Gpcr26, Mrec1.3, rec.1.3
Description of Target:
The integral membrane protein encoded by this gene is a lysophosphatidic acid (LPA) receptor from a group known as EDG receptors. These receptors are members of the G protein-coupled receptor superfamily. Utilized by LPA for cell signaling, EDG receptors mediate diverse biologic functions, including proliferation, platelet aggregation, smooth muscle contraction, inhibition of neuroblastoma cell differentiation, chemotaxis, and tumor cell invasion. Two transcript variants encoding the same protein have been identified for this gene
Protein Size (# AA):
364
Molecular Weight:
40 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LPAR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LPAR1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human LPAR1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-LPAR1 (ARP84602_P050) antibody is Catalog # AAP84602
Datasheets/Manuals:
Printable datasheet for anti-LPAR1 (ARP84602_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...