MC3R Antibody - middle region (ARP79707_P050)

• Product Number: ARP79707_P050
• Name: MC3R Antibody - middle region (ARP79707_P050)
• Protein Size (# AA): 323 amino acids
• Molecular Weight: 35 kDa
• NCBI Gene Id: 4159
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: melanocortin 3 receptor
• Alias Symbols: MC3, OB20, OQTL, BMIQ9, MC3-R
• Peptide Sequence: Synthetic peptide located within the following region: CCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MC3R (ARP79707_P050) antibody is Catalog # AAP79707
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MC3R
• Uniprot ID: P41968
• Protein Name: melanocortin receptor 3
• Protein Accession #: NP_063941.3
• Purification: Affinity purified
• Nucleotide Accession #: NM_019888.3
• Tested Species Reactivity: Human
• Gene Symbol: MC3R
• Predicted Species Reactivity: Human
• Application: WB
• Image 1: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: MC3R
  Sample Tissue: Human HT1080 Whole Cell lysates
  Antibody Dilution: 1ug/ml