Search Antibody, Protein, and ELISA Kit Solutions

MC3R Antibody - middle region (ARP79707_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MC3R
Official Gene Full Name:
melanocortin 3 receptor
NCBI Gene Id:
4159
Protein Name:
melanocortin receptor 3
Swissprot Id:
P41968
Protein Accession #:
NP_063941.3
Nucleotide Accession #:
NM_019888.3
Alias Symbols:
MC3, OB20, OQTL, BMIQ9, MC3-R
Description of Target:
This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Protein Size (# AA):
323
Molecular Weight:
35 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MC3R.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MC3R.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MC3R
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: CCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MC3R (ARP79707_P050) antibody is Catalog # AAP79707
Datasheets/Manuals:
Printable datasheet for anti-MC3R (ARP79707_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...